20% OFF shipping at nj-cca.org on orders over $79 + up to 10% OFF products
nj-cca.org
home > Recombinant Swine IGF-I protein(N-His) - PKSS000020 > Recombinant Swine IGF-I protein(N-His) - PKSS000020
download picture
Recombinant Swine IGF-I protein(N-His) - PKSS000020Recombinant Swine IGF I protein(N His) Size: 20g Catalogue Number: PKSS000020 20 Citations, Manuals and MSDS Available upon request. Abbreviation: IGF I Target Symptom: Somatamedin C; IGF IA; Npt2B Target Species: Porcine Expression Host: E. coli Fusion Tag: N His UNIProt ID: P16545 Accession: P16545 Background: IGF I, also known as mechano growth factor, somatomedin C, IGF I and IGF1, is a secreted protein which belongs to the insulin family. The
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

Recombinant Swine IGF-I protein(N-His)

Size: 20μg

Catalogue Number: PKSS000020-20

Citations, Manuals and MSDS Available upon request.

Abbreviation: IGF-I

Target Symptom: Somatamedin C; IGF-IA; Npt2B

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: P16545

Accession: P16545

Background: IGF I, also known as mechano growth factor, somatomedin-C, IGF-I and IGF1, is a secreted protein which belongs to the insulin family. The insulin family, comprised of insulin, relaxin, insulin-like growth factors I and II ( IGF-I and IGF-II ) and possibly the beta-subunit of 7S nerve growth factor, represents a group of structurally related polypeptides whose biological functions have diverged. The IGFs, or somatomedins, constitute a class of polypeptides that have a key role in pre-adolescent mammalian growth. IGF-I expression is regulated by GH and mediates postnatal growth, while IGF-II appears to be induced by placental lactogen during prenatal development. IGF1 / IGF-I may be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. IGF1 / IGF-I stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. Defects in IGF1 / IGF-I are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation.

Sequence: MGKISSLPTQLFKCCFCDFLKVKMHITSSSHLFYLALCLLSFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKEVHLKNTSRGSSGNKNYRM

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 8.0
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: Please contact us for more information.

Calculated MW: 17.83 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

Recombinant Swine IGF-I protein(N-His) - PKSS000020

Item no : 70449868511
sold recently : Login >>
US$ 346.50
Pay in 4 interest-free payments of $86.62 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Enjoy 20% off shipping

US$ 346.50

1-11

US$ 311.85

12-35

US$ 242.55

36-59

US$ 207.90

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Bananas Hat
Bananas Hat

US$ 10.00

Min. order: 1 piece

4.4 (203 reviews)

Sold : Login>>

Related Searches