20% OFF shipping at nj-cca.org on orders over $79 + up to 10% OFF products
nj-cca.org
home > Recombinant Human AITRL protein(N-His)(active) - PKSH034121 > Recombinant Human AITRL protein(N-His)(active) - PKSH034121
download picture
Recombinant Human AITRL protein(N-His)(active) - PKSH034121Recombinant Human AITRL protein(N His)(active) Size: 100g Catalogue Number: PKSH034121 100 Citations, Manuals and MSDS Available upon request. Abbreviation: AITRL Target Symptom: TL6; GITRL; TNLG2A; hGITRL; TNFSF18 Target Species: Human Expression Host: E. coli Application: Cell culture Fusion Tag: N His UNIProt ID: Q9UNG2 Accession: Q9UNG2 Background: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF)
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

Recombinant Human AITRL protein(N-His)(active)

Size: 100μg

Catalogue Number: PKSH034121-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: AITRL

Target Symptom: TL6; GITRL; TNLG2A; hGITRL; TNFSF18

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: Q9UNG2

Accession: Q9UNG2

Background: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.

Activity: Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 2. 5 ng/mL.

Sequence: MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 21.13 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

Recombinant Human AITRL protein(N-His)(active) - PKSH034121

Item no : 50637553754
sold recently : Login >>
US$ 517.30
Pay in 4 interest-free payments of $129.32 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Enjoy 20% off shipping

US$ 517.30

1-11

US$ 465.57

12-35

US$ 362.11

36-59

US$ 310.38

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches